PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010105229.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family YABBY
Protein Properties Length: 195aa    MW: 22059 Da    PI: 8.4116
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010105229.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY218.91.5e-6761674170
           YABBY   4 fssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesast.svs 97 
                     + ++eq+Cy+ CnfCn +lavsvP +sl+ +vtvrCGhCt+l svn+a a q l+ +++       + + + ++ + n+  + + + s+s+ +v+
  XP_010105229.1   6 DVAPEQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCTNLWSVNMAAAFQSLSWQQDH------HHHLQAQNYNYNVPDYRIDSGSSSRcNVN 94 
                     5689********************************************999999988761......11222223333444444444433331444 PP

           YABBY  98 seklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                     +  +   + ++v++   v+rPPekrqrvPsayn+fikeeiqrika+nP+ishreafs+aaknWahfP+ihfgl
  XP_010105229.1  95 KLAMRAPNANNVSEERVVNRPPEKRQRVPSAYNQFIKEEIQRIKANNPEISHREAFSTAAKNWAHFPHIHFGL 167
                     45667888889999899******************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.5E-718167IPR006780YABBY protein
SuperFamilySSF470951.44E-7112160IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.102.1E-4115161IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:1902183Biological Processregulation of shoot apical meristem development
GO:2000024Biological Processregulation of leaf development
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MSSCVDVAPE QLCYIPCNFC NIVLAVSVPC SSLLDIVTVR CGHCTNLWSV NMAAAFQSLS  60
WQQDHHHHLQ AQNYNYNVPD YRIDSGSSSR CNVNKLAMRA PNANNVSEER VVNRPPEKRQ  120
RVPSAYNQFI KEEIQRIKAN NPEISHREAF STAAKNWAHF PHIHFGLMLK TNNQTKLDNG  180
SEKHLMPSRA ANALM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0902169e-64BT090216.1 Soybean clone JCVI-FLGm-3N14 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010105229.11e-146hypothetical protein L484_012344
SwissprotQ8GW463e-83YAB5_ARATH; Axial regulator YABBY 5
TrEMBLW9RQQ71e-146W9RQQ7_9R
STRINGVIT_11s0016g05590.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112434112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G26580.22e-84YABBY family protein